PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032825.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 548aa    MW: 60831.6 Da    PI: 4.373
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032825.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.86.4e-4771342129
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  +pGfrF+Ptd el++++Lk+k+ gk+l++ +vi+evd+yk++PwdLp k   ++++ +wyfF++r+kkya+g+r +rat  gyWk+tgkd++vl+ +g
  Pbr032825.1   7 APGFRFKPTDVELLKYFLKRKLIGKRLHV-KVISEVDVYKHDPWDLPdKsGWDSGDLKWYFFCPREKKYARGNRIQRATVGGYWKTTGKDRSVLC-SG 102
                  59***************************.99**************95335556777**************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  ++vg  ktL+f++grap+g +tdWvmheyrle
  Pbr032825.1 103 AVVGWIKTLIFHTGRAPHGDRTDWVMHEYRLE 134
                  9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-554156IPR003441NAC domain
PROSITE profilePS5100552.7796156IPR003441NAC domain
PfamPF023658.6E-238133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MGKMFKAPGF RFKPTDVELL KYFLKRKLIG KRLHVKVISE VDVYKHDPWD LPDKSGWDSG  60
DLKWYFFCPR EKKYARGNRI QRATVGGYWK TTGKDRSVLC SGAVVGWIKT LIFHTGRAPH  120
GDRTDWVMHE YRLEDQGLAD RGVPLDSYVL CMIFQKEGLG PRNGAQYGKP FNEEDWSDDE  180
VAEGSQDANT PGPYLGLPCS ENSPIATNTH SLEDVGIGPP SGSCISDILP QSCKVLQPVS  240
SNYVTMEKSH ASHGDDIPPT FDYSREENTF FMSENGKSMA EIHSEAVPNE SMPTPNHVLP  300
SNHNGFACTS AFFSERIGIG PSESLMSDIE PPHYNVLQLE TGNYVTTEKA HMSDGDILSM  360
FDYFTEESTL YMYGNDKIET GGCLETVLSA NIPEPGQMLW SNYNTFISTS TQPSEVIGVG  420
PSFQSCGLDV LPPSWEVVPP VSCNYVTMEK TPASNGDDIL PMLDCFVEES AFHMNENHNN  480
EELDNFIDFG NNAQAIPQLN TSNMYENLED LGNNLDGYNF SGGHDDCANH FLELGDLDQP  540
MNGDNSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-44815717169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341181.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLD9ZJ930.0D9ZJ93_MALDO; NAC domain class transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-90NAC domain containing protein 103